SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925335|ref|YP_003321958.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925335|ref|YP_003321958.1|
Domain Number 1 Region: 2-197,368-453
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.86e-66
Family Bacterial dinuclear zinc exopeptidases 0.001
Further Details:      
 
Domain Number 2 Region: 301-364
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000227
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925335|ref|YP_003321958.1|
Sequence length 456
Comment peptidase M20 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSDEVFSRIDASSHKYLEDLKEFLRIPSISALSDYKAEVARCAQWLKEHMITIGLQKAEV
IPTSGHPIVYGEWMGSDSGRTILVYGHYDVQPPDPLDLWQTPPFEPSVREGRIYARGAVD
DKGQVMMHLKAVQSLLEEYGKLPVNLKFIIEGEEEIGSPSLDEFLVQNKDRLSSEAVVIS
DTGWIAPGVPSITYALRGLSYIQVDVYGPKSDLHSGSYGGAVMNPAEAIACIIASLKDDK
GRIKVDGFYDKVVELTSQEREEFSKLPFDEESFRQALGVDQLYGEEGYSTLERLWARPTL
DVNGIWGGFTGEGSKTVIPAEAHAKISCRLVPDQDPEEISDLLETYIRKITPPGVRVEIQ
RMHGGKPAIVPIDHPINQAAARALEKAFGKKAVFIRAGGTIPVVASLKEILGLPSILMGM
GLPDENAHAPNEWFLLDNFYGGIKSVAALWLDLGAA
Download sequence
Identical sequences D1CDY0
WP_012874171.1.85100 gi|269925335|ref|YP_003321958.1| 525904.Tter_0214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]