SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925349|ref|YP_003321972.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925349|ref|YP_003321972.1|
Domain Number 1 Region: 4-344
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-111
Family AAT-like 0.0000000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925349|ref|YP_003321972.1|
Sequence length 353
Comment threonine aldolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MHVIDLRSDTVTLPTEEMRKAMAEAEVGDDQSREDPTVNKLEELAAEIIGKEAALFVPSG
VMGNLCAMLVHCERGQEVIMGDQSHILWYESGSGAALGGLVYRSVHNGRFGELNPSEVEE
TIRPERLGFPRTGLVCLENTHNRCGGTVLNLQQIEGIVDVAHRHNVPVHMDGARIFNAAI
YLGVPAKELAKPVDSIEFCLSKGLSAPVGSIVAGSEGFVREARRVRKLLGGAMRQSGVIA
AAGIVALEKMIDRLHEDHVNARKIAEGIVDLDGIRLDLETVQTNIVAFDLVSPDWTPPKL
ISELESRGLRISSYGGRKMRIVTHYGISDDEYDQAIKIFRDVLTGTYVSYPQH
Download sequence
Identical sequences D1CDZ4
WP_012874185.1.85100 gi|269925349|ref|YP_003321972.1| 525904.Tter_0228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]