SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925455|ref|YP_003322078.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925455|ref|YP_003322078.1|
Domain Number 1 Region: 217-487
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.42e-62
Family PFOR Pyr module 0.0055
Further Details:      
 
Domain Number 2 Region: 21-238
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 3 Region: 502-602
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000314
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925455|ref|YP_003322078.1|
Sequence length 607
Comment pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSLAEDIKAIPVGKTPEVINDFSIVAATVNGSGSQTSNLTLIRALFRMGIPVNGKNLFPS
NISGLPTWYTIRVNKDGYIARKERAEILVAFNPQTAAEDIQALPPGGVCIYPAESKLPLV
RDDIVYYSVPVKPFVEATGADPKLREKFASMVYVGALAELLGIDRQEIRAALSQQFRGKE
KVVDQNFQVIVSAADWVKENITKKDPYRVERMEATRGKILIDGNSAAALGAIFGGVTVAA
WYPITPSTSLIEALQSYLPKLRTDKDGNHTYAVVQAEDEMAALGIVLGAGWAGARAMTST
SGPGISLMTEFAGLGFFAEIPGVIWDIQRIGPSTGLPTRVSQGDVLKVYFLGHGDTRHVC
LIPGTVAECFEFGYKAFDLAERLQTPVFVLSDLDLGMNLWMSDPFEYPSEPMDRGKVLSA
EDLQRIGEFARYRDVDGDGIPYRTLPGTDHPLAAYFTRGSGHNEYAQYSERPDDWRRNME
RLRRKHETARKLVPKPVIESWADSSVGIVSFGSVHHPVMEAIDLLAEKGLSTDYLRIRAL
PLEETLREFIRKHDRTYVIELNHDGQMVNLIRMEFPEVADKVISIAYCDGLPMTANYIAN
ALLEKEC
Download sequence
Identical sequences D1CEA0
gi|269925455|ref|YP_003322078.1| WP_012874291.1.85100 525904.Tter_0334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]