SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925605|ref|YP_003322228.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925605|ref|YP_003322228.1|
Domain Number 1 Region: 4-607
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 7.72e-201
Family Prokaryotic type I DNA topoisomerase 0.000000000295
Further Details:      
 
Weak hits

Sequence:  gi|269925605|ref|YP_003322228.1|
Domain Number - Region: 676-707
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00102
Family DnaJ/Hsp40 cysteine-rich domain 0.0073
Further Details:      
 
Domain Number - Region: 634-672
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00108
Family Transcriptional factor domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925605|ref|YP_003322228.1|
Sequence length 711
Comment DNA topoisomerase I [Thermobaculum terrenum ATCC BAA-798]
Sequence
MANKLVIVESPTKAKTISRYLGRGYSIKASMGHVRDLPKSKLGVDTEHDFQPQYLIPRDK
SKTVKELKESVASAREVYLATDPDREGEAIAWHLIQATGMDTSKARRVVFHEITPDAVRN
AMANPREIDMRLVDAQQARRVLDRLVGYNISPLLWKKVKRGLSAGRVQSVALRLVVDRER
EIQSFVPVEYWTISADLAKQPAKGRKPSRKDQFRALLVRINDEKVEISNEEQARAIIEAL
EGATYKVLEVKQREIQRKPAPPFITSTMQQEASRKLNFNARRTMSVAQSLYEGVSLGDEG
DVGLITYMRTDSTNVATVAQEEARQVIAQLFGDKYLPEKPPVYTKKAKNAQEAHEAIRPT
SVKRHPDAIKQYLTSDQYKLYKLIWQRFIASQMANAIIDGTTVDIAAEPRSGGAPYIFRA
TGSVIKFDGFLVVYQEGKDDDQEEELGSKALPPMTEGEVLNLIQLLPEQHFTQPPPRYTE
ASLVKALEEQGIGRPSTYAIILSTLQERYYVVKDGKALVPTELGMLVNDLLVEHFPDIVD
VNFTSQMEEELDDIASGERAWVPVIKEFYGPFERKVRIAEEEMQKVDIQDEPAGENCPNC
GRPMVFKMGRYGKFIACSGFPECRTTKAIVNRTGVQCPACRQGELVERRSRKGRRSIFYA
CDRYPDCEFTISAKPLPQPCPACGGLQVEDGKNGQKCIRCDGQGNILQKSA
Download sequence
Identical sequences D1CEQ0
gi|269925605|ref|YP_003322228.1| 525904.Tter_0485 WP_012874441.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]