SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925610|ref|YP_003322233.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925610|ref|YP_003322233.1|
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 1.69e-24
Family Ribosomal protein L31p 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269925610|ref|YP_003322233.1|
Sequence length 94
Comment 50S ribosomal protein L31 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKPNIHPQYVEATVHCSCGNTWKTRSTKPNIRVDLCSKCHPFFTGEQRIVDTAGQVDRFM
RRLERRQAGRGGGTPVTIPAEERPTVAEAESQEQ
Download sequence
Identical sequences D1CEQ5
525904.Tter_0490 gi|269925610|ref|YP_003322233.1| WP_012874446.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]