SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925668|ref|YP_003322291.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925668|ref|YP_003322291.1|
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.45e-16
Family HD domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269925668|ref|YP_003322291.1|
Sequence length 297
Comment metal dependent phosphohydrolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEEESNRATSIDRQESEGFDLPQEPGPEVSPSGTTPLQPSEIIRLPTRHNPTLQKLVGIV
NSDEDLHAIWRCQNVNGVDRLGMSDHGPVHVQIVANLALRLLRLLMAKNIQPSIVKDHGM
SEHDAEVVVVLAALLHDCGMSIHRDDHEFMSLFIALPKLQELLSNLYSAAERRVIISETL
HAIITHRSDGRPLTLEAGIVRVADALDMAQGRSRIPFESGHVNIHSVSAAAIEKVEINQG
QEKAIRVTIYMSNAAGIFQIDELLRQKLKGSGLETHVEVVAQVTGESDKRLVETFKF
Download sequence
Identical sequences D1CEW3
gi|269925668|ref|YP_003322291.1| 525904.Tter_0551 WP_012874504.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]