SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269925780|ref|YP_003322403.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269925780|ref|YP_003322403.1|
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4e-83
Family Histidine biosynthesis enzymes 0.000000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269925780|ref|YP_003322403.1|
Sequence length 251
Comment Imidazole glycerol phosphate synthase cyclase subunit [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLTKRVIPCMDVKDGKVVKNYQYFTPLPDAGDPVELASIYNAQGADELMFLDITASVEGR
KLIIDLVNRTANEIFIPLTVAGGISSVEDMHRVLRAGADKVAINTAAAWNPDLITAGAER
FGSQCIVVAIDAKKETDDWYVYTHGGRKPTGKRAVDWAREAQDRGAGEILLTSIDRDGTG
EGYDLDLLDIVASAVSIPVIASGGASTPDHFVEAIQHGADAVLAASMFHYGHYTVSQAKK
RMSECGIPVRL
Download sequence
Identical sequences D1CF75
gi|269925780|ref|YP_003322403.1| 525904.Tter_0664 WP_012874616.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]