SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926083|ref|YP_003322706.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926083|ref|YP_003322706.1|
Domain Number 1 Region: 7-198,311-384
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.4e-50
Family Bacterial dinuclear zinc exopeptidases 0.00017
Further Details:      
 
Domain Number 2 Region: 189-299
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.31e-23
Family Bacterial exopeptidase dimerisation domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926083|ref|YP_003322706.1|
Sequence length 385
Comment peptidase dimerization domain-containing protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSQVPSYTKLYAFYQDGLQEYLRDLQMLVNQDSGTEYKEGVDRVADMCIDKLASFGCSIE
RIPSEVYGDAIIAKVEASSKRKVILIGHMDTVYPKGTAELRPFTIKGEYAYGPGVADMKS
GLLLGIYTLRLCKHIVKKLDREVVMVLNSDEEVGSPFSAEIIRNEAKGATAAFVLEPGRP
RSSVVVARKGVYNYELIAKGRSAHAGANPRDGRNAIVALAKAITEIAQWDKYPKGVTINA
GTISGGTKPNVVPDFASAYLDVRVRRTADLEAVEEHFAQISERLSKDGVNVQFHRVGSCF
PPMEPSEGNRWLYELAKDLAQEIGFELGAVETGGASDANNIAMMGVPVLDGLGPVGEKAH
SPEERMFIPSIAERGALLSSLILRV
Download sequence
Identical sequences D1CG28
gi|269926083|ref|YP_003322706.1| 525904.Tter_0967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]