SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926113|ref|YP_003322736.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926113|ref|YP_003322736.1|
Domain Number 1 Region: 5-196
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.65e-68
Family HD domain 0.00000319
Further Details:      
 
Domain Number 2 Region: 187-397
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.6e-64
Family RelA/SpoT domain 0.0000119
Further Details:      
 
Domain Number 3 Region: 380-452
Classification Level Classification E-value
Superfamily TGS-like 7.19e-25
Family G domain-linked domain 0.022
Further Details:      
 
Domain Number 4 Region: 633-712
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000216
Family AF1403 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926113|ref|YP_003322736.1|
Sequence length 721
Comment (p)ppGpp synthetase I SpoT/RelA [Thermobaculum terrenum ATCC BAA-798]
Sequence
MGYWETLDKGTNYLSSLDKDLIRRAYEVADKAHEGEYRKSGEPFISHPVNVALILADLKQ
DAQAIASALLHDTVEDTNLTLDDIETIFGPEVSRLVDGLTKLNKIRLSPDDEKDPKEQQA
QAENLRKMFLAMVEDPRVVLIKLADRLHNMRTIEHLPRDKQLSKARETLEIYAPLAGRLG
IFKFRSELEDLSFKVLYPDKYREIAAQVERSGVTRGKYIEQAIDVLKKALDAEGIPAEIT
GRRKHLYSIYRKMEQKQRSFDQIFDVLGLRVITDEVMQCYAALGVIHSIWRPIPGEFDDY
IAMPKESMYQSLHTAVVGLDGKPLEIQIRTRDMHEVAEYGIAAHWRYKEGKKANEAAEHR
ITWLRQLLEWRDEVADAQEFVESMKSDLLQEHIYVFTPNGDVVELPRGATPIDFAYRIHT
EIGHHCVGATVNGRLVSLDYVLQNGDVVKIRTSKTKQGPSRDWLNPAYGYVRTASAREKI
RQWFRKQERTENIAQGREMVERELRRLGLEHLKLEEVAAHFPNYQKLDDFLAAVGYGAIN
TSQIAGKLVVQEQKTIMSETLPKAVAAATDVKVMGVGDLLTTLARCCSPMLGDEILGYVT
RGRGVSIHRADCPNIQKADPERIIQVSWDGTQKQLYSVVLQVVAIDRVGLLRDVSTVVSN
EKINMRDVQTFDHKDHTVTIQFAVEVADGAELSRLLLKLERLPDVIEVRRRTPSASAAKT
A
Download sequence
Identical sequences D1CG58
WP_012874949.1.85100 525904.Tter_0998 gi|269926113|ref|YP_003322736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]