SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269926158|ref|YP_003322781.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926158|ref|YP_003322781.1|
Domain Number 1 Region: 416-651
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000235
Family NHL repeat 0.012
Further Details:      
 
Domain Number 2 Region: 55-204
Classification Level Classification E-value
Superfamily PP2C-like 0.0000523
Family PP2C-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926158|ref|YP_003322781.1|
Sequence length 671
Comment hypothetical protein Tter_1043 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSKIQVNTAQIGIISGIRQDQTDFALEGGRDRPSRILRSRGKLWILTQPACPSVGATTAA
KLVMETVEESYYTSNSPTITGALEEAINQANRLMYEYNSGAPIHKQAYLGISCIVLHDQE
VYIAQVQPAAILVIHGGEVSFFPPDGPLPEEELTPLGLEQRAEVELHRSGFMQGDTVVAL
STDLASALYESAKEEFLYDDYEVIIDKLFALSIERSILDGHALVIEFPDSPNKRPISSNI
PSWQSISTWVQNKLKIDGHLVHKGSKDKHTPNTDDQGWPIPLVRIKSSNGFWTSAGRILK
HRFQSRALIARTASIIGIVLIFALAMALGARAFEGFQRVNKVENLLSRAQKEISAAHNTS
LQEAVRHLQNAQSLVADAEKIDPSSTKIAVVRAAIQSNWEKVRKIEHLKNLKLLGTVPGL
RTSADAKIILLDNKVVVLNKDSGRVYIKNITGGGPGFISPSRSVRFIGISWREGGLLILD
RAGRLFDYDFTSGRWTQTRLGGNWDWDKVTGFDTYGTRAYVSLKGFNGILEYDIRNPGAA
SIIRGNRKGITFSSSSLGADGNVWALSPRDGSLIQITDGKINKKLWIEASPPVTAPFGIV
ALDTNQHLYFLDEGRDRILEMSADGQLVAQLIPDLPGRVTGNISAVFVDEANAKLILLAG
NKLYYGKLPSS
Download sequence
Identical sequences D1CGA3
525904.Tter_1043 gi|269926158|ref|YP_003322781.1| WP_012874994.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]