SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926296|ref|YP_003322919.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926296|ref|YP_003322919.1|
Domain Number 1 Region: 12-395
Classification Level Classification E-value
Superfamily Citrate synthase 1.23e-122
Family Citrate synthase 0.0000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926296|ref|YP_003322919.1|
Sequence length 395
Comment citrate (Si)-synthase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSNSGATNSDASDRSHHAVASGLEGIVVAQTELSDVDGLHGKLCIRGYDVEEIATKAIFE
EVAFLLWHGRLPKKPELEELHSNLAVARRLPEETIAALNFAAKRMHPMDALRFAVASLTA
DDPNIEDDSRENNLHRAITLTARVPVIVATYHRLRSGLSVPEPKDDWGIAANFLYQLKGS
EPDPAEVRALNTYLVTVADHGMNASTFTARVIASTQSDMVSAITGAIGALKGPLHGGAPE
GALEMIEAIGTPDRAESWMREAISQGKRLMGFGHRIYKVRDPRAEVLYRAAEALADETGE
KEALALAREVERVGVRILAEYKPGRNLNTNVEFYTALLLRELGLTKDLFTPTFAIGRTAG
WTAHILEQKSSGRLIRPESEYIGPRDLKYVPLEMR
Download sequence
Identical sequences D1CBD2
WP_012875132.1.85100 gi|269926296|ref|YP_003322919.1| 525904.Tter_1189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]