SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926300|ref|YP_003322923.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926300|ref|YP_003322923.1|
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 4.06e-32
Family Type 2 phosphatidic acid phosphatase, PAP2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926300|ref|YP_003322923.1|
Sequence length 192
Comment phosphoesterase PA-phosphatase-like protein [Thermobaculum terrenum ATCC BAA-798]
Sequence
MNSIDTQLLLKLNSMVGKNPVVDVLVQLLVNEYFVPVSLSLVLLFMWFGAKELENLRWKL
GAINAAIGVGIANIIVATSNIFYFRDRPFMHLDVNLLFYRPTDSSFPSNAAAVAMALAIG
ISLHDKRLAPLVLPLAASIGIARVMAGVHYPSDVLAGWIVGALAAFIALLITNFLRPFIE
RLILAAKNLGLA
Download sequence
Identical sequences D1CBD6
WP_012875136.1.85100 gi|269926300|ref|YP_003322923.1| 525904.Tter_1193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]