SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926332|ref|YP_003322955.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926332|ref|YP_003322955.1|
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 7.85e-29
Family Thiamin pyrophosphokinase, catalytic domain 0.0037
Further Details:      
 
Domain Number 2 Region: 142-209
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000000955
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926332|ref|YP_003322955.1|
Sequence length 230
Comment thiamine pyrophosphokinase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MLAVLVSGGEISSPELFSPLFREADFLVAVDSGYHLFQVAGVKPNLLVGDLDSISPEMLA
HAREAAVDLITFPTEKDYTDTELAIKQAVDNGCSTILVVAPFGDRIDHTLANVLLLTSPK
FRNYDLRLLNEFQEVRLIKGSISIRSHPGEVISLLPLSDVVEGITTAGLYYRLQDANMIR
GPALGISNVATSEIVSVSVVSGDLLLVRIFQNGLDPSEYIRNELGCKSLD
Download sequence
Identical sequences D1CBG8
WP_012875168.1.85100 gi|269926332|ref|YP_003322955.1| 525904.Tter_1225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]