SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926392|ref|YP_003323015.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926392|ref|YP_003323015.1|
Domain Number 1 Region: 11-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-29
Family MarR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926392|ref|YP_003323015.1|
Sequence length 157
Comment MarR family transcriptional regulator [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEEENLARFRRAYWKVVHLVDALRLRLWEDKGLTLPQLRVLFILRRHPGATTNFISQQLG
VTVSTVSGLVDKLVRAGLVERLQAPDDRRVIPLRLTPEGESVVGDIRQINREYLANIASA
LGDDLEEVTQALEKLGSAAETLPPPSNPLEVSVEPER
Download sequence
Identical sequences D1CBM8
gi|269926392|ref|YP_003323015.1| 525904.Tter_1285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]