SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926395|ref|YP_003323018.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926395|ref|YP_003323018.1|
Domain Number 1 Region: 9-224,323-382
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.29e-45
Family FAD-linked reductases, N-terminal domain 0.00000876
Further Details:      
 
Domain Number 2 Region: 223-323
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.02e-18
Family D-aminoacid oxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926395|ref|YP_003323018.1|
Sequence length 389
Comment sarcosine oxidase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MGSSNNASYDVAVVGLGAMGSATAYMLASRGYRVIAFDTYSPPHSLGSSHGESRIIREAY
FESPQYVPLVRRSYELWRLLEEDANTRLLTITGGLYVGPRDGELISGVLSSSQQWNIPCE
LLTSDELRHRYPEIHVPENLEAILEPGVGVLQPEACISSFLQGAAARGVHLHMREKVLSW
RTEGSGFRVFTSLSPSGYLAERVILTVGPWAPEILADIGVPLQVLRVFVAYFRRGDERDG
IDGHNLPVHLWQLPEGTYYGMPYNKRVGMKFGRHDDGTPCTPDTIARGVTPDEIERLKSI
VAKLIPSISHPVDASTCMYTMTPDQHFVVDHHPFQSGVVLACGFSGHGFKFAPVIGEILA
DLAIEGRTSHPIDFLSLKRFTPSGATQHA
Download sequence
Identical sequences D1CBN1
525904.Tter_1288 gi|269926395|ref|YP_003323018.1| WP_012875231.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]