SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926430|ref|YP_003323053.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926430|ref|YP_003323053.1|
Domain Number 1 Region: 6-226,316-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-42
Family FAD-linked reductases, N-terminal domain 0.0087
Further Details:      
 
Domain Number 2 Region: 227-316
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000994
Family D-aminoacid oxidase-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269926430|ref|YP_003323053.1|
Sequence length 375
Comment FAD dependent oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MRQLSSDVAIIGAGVVGAACAYFLAEMGHSPTIIDPMEQGAATPAGAGIVAPGVTFHPSP
YYFPLAYRAVSYLEGLVDKLGNERLLERCGLLYLITDPRSPVDAESLARQLRRHGMEGAP
MHGHVEVIDPEYVHRYFPLLVPSQGAVYVDGPGRLNGANLRDALLLQAIKRGAHYIRARA
SIDSISQQEIALKADSTTITTQRLVLAAGAWSRQIIGQFSAVSLPISPQRGQILHLEVPD
TRTDQWPIVMGDFPHYLLTFPVCKVLAGATHEDVGFHPKPTLAGIREIADTIYKVAPSLG
SARLLGVNVGLRPVTPDGLPIIGRVPDLPSVIVASGHGAYGLQLGPYTGMLAAQLATDQE
PDMDLTPYSPLRFSS
Download sequence
Identical sequences D1CBR6
gi|269926430|ref|YP_003323053.1| 525904.Tter_1324 WP_012875266.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]