SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926452|ref|YP_003323075.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926452|ref|YP_003323075.1|
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.00000000000889
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.012
Further Details:      
 
Domain Number 2 Region: 90-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000627
Family Prokaryotic DksA/TraR C4-type zinc finger 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926452|ref|YP_003323075.1|
Sequence length 126
Comment TraR/DksA family transcriptional regulator [Thermobaculum terrenum ATCC BAA-798]
Sequence
MAIRDQQISELRKRLEDERARLVSELRDLQSDASQWGESVRDEDSSYGNHMADEGTDTFE
QEKEIALQRNLRSVLNEIEAALKRMDEGTYGICIDCGQEIPIERLMARPYAVRCVADQEK
YDRVHR
Download sequence
Identical sequences D1CBT8
525904.Tter_1346 gi|269926452|ref|YP_003323075.1| WP_012875288.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]