SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926470|ref|YP_003323093.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926470|ref|YP_003323093.1|
Domain Number 1 Region: 168-478
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.04e-112
Family Leucine aminopeptidase, C-terminal domain 0.000000276
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000000000406
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926470|ref|YP_003323093.1|
Sequence length 492
Comment leucyl aminopeptidase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKITYRVGGLLESESRYIAVPMFAGQDMPYMNQIDSNTPSTDLVDVASQKEQVSLINTGQ
QDKFILLIGMGELSNTLEAIRKFSGAAVRWARKRKIDNLSIFLPSLSNPNNALVAAAVHG
AIVGNFSPETYKTSSQEINVESTEFILESSGSDISDMEATINRATAIGESVNLARTLANE
PPNVLTTREFARRAQSLCEVNGLTCEILEEEDLRQRGYSAILAVASGSSEPARMVIIKYE
ASDSPYTIGFVGKGITFDTGGISLKPAENMHRMKSDMSGAAAVLGAMIAISKIKPKVNVV
GVLCLAENMPSGSAMRPGDVIKAGSGKTIEVLNTDAEGRLVLADGIVQAKKEGATHLVDV
ATLTGACVVALGTITTGVFGSHQYWTDIVLNAASQVGEKMWQMPTFAEYREQLDSDIADI
ANSGGREAGAITGALFIKEFAEDTPWVHLDIAGTAWNNKDLPHIAKGPTGVATATLTKIA
DIVASRGIDSNG
Download sequence
Identical sequences D1CBV6
gi|269926470|ref|YP_003323093.1| 525904.Tter_1364 WP_012875306.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]