SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926500|ref|YP_003323123.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926500|ref|YP_003323123.1|
Domain Number 1 Region: 2-90,127-235,415-447
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.66e-29
Family Bacterial dinuclear zinc exopeptidases 0.01
Further Details:      
 
Domain Number 2 Region: 224-328
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000012
Family Bacterial exopeptidase dimerisation domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926500|ref|YP_003323123.1|
Sequence length 533
Comment peptidase M20 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSIENVLSIILRLVKHPSFTRTEGERSIPALIDELLDEIGLGLLQHGIQKIAGDPWERSF
VWALLRGSSNNAVVLISHFDTVDVSDYGDLGSYACDPGALRERLLSRREQLDDIVYEHLR
AESDWLFGRGTVDMKAGIAAHLWALSEFCKEKLQGKELPGSIIFLSVPDEEAESIGIMGA
VEWLSTLAEKEGLRLIGAINTDYSTPSSREEMDSTMHVGTIGKLLPSIYVRGVESHAGEP
SKGIDANLLLARIVSKISMNPDLADTDNDVRSVAPVTLKMCDFKDSYDVRIPFESFCYIN
YLVLRKSPKNVIDEIAALVNAAIVESLGDIDINIPGVTPKVVTYDELVEAAVSILGKDKV
AQALREINQRLFESGTDSRMRCAELVRTAWNMSGMSGPAAVVYFSPPYYPSVKGGEDNPL
VRAVTELAANLGTKIQHYYPYISDASYMKLEVESSSLDSLSKNMPIWSNKRESGSYNVPF
ESMRKVNLDVVNMGVLGFDAHKYTERLYIPYSCEFLPKAIHDVVLAAWENANG
Download sequence
Identical sequences D1CBY6
525904.Tter_1394 gi|269926500|ref|YP_003323123.1| WP_012875336.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]