SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926533|ref|YP_003323156.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926533|ref|YP_003323156.1|
Domain Number 1 Region: 62-400
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-75
Family Extended AAA-ATPase domain 0.0000000118
Further Details:      
 
Domain Number 2 Region: 11-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000271
Family ClpX chaperone zinc binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269926533|ref|YP_003323156.1|
Sequence length 422
Comment ATP-dependent Clp protease ATP-binding subunit ClpX [Thermobaculum terrenum ATCC BAA-798]
Sequence
MSNSRSSRSSYKCSFCGKRQEDVRRLIAGPGAVYICNECVDLCREIIDEEESAGLRREPA
PSRIPPPKKIYELLDNYVVGQDRAKKTLSVAVYNHYKRVAADMQIDDVELQKSNILMIGP
TGSGKTLLAQTLAKILDVPFSIADATALTEAGYVGEDVENILLRLIQAADLDIQRAERGI
IYIDEIDKIARKGDNPSITRDVSGEGVQQALLKIIEGTVANVPPQSGRKHPHQEFIQIDT
TNILFICGGAFEGLEDIVAKRIGAKRSLGFARQEYDSGQSEGSVLQHVIPEDLLKFGLIP
EFIGRLPVVVTLDPLTKEDLIHILTKPKNAIIKQYQKLMALDNVELQFTNDALEAAAEEA
IARKTGARGLRSTIEEVLLETMYEIPSLTGVRKCIVDGDTIRNRSKPKLVTWEDSKQLEE
SA
Download sequence
Identical sequences D1CC19
gi|269926533|ref|YP_003323156.1| WP_012875369.1.85100 525904.Tter_1428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]