SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926632|ref|YP_003323255.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926632|ref|YP_003323255.1|
Domain Number 1 Region: 10-176
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.18e-53
Family TK-like Pyr module 0.009
Further Details:      
 
Domain Number 2 Region: 181-314
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 3.93e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926632|ref|YP_003323255.1|
Sequence length 319
Comment transketolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MKIETLRFGKAMRDVWGDTLCEIMANDQKVVVLDGDLANSTKADKVAERFPDRFFQMGIA
EQNMAGAAAGLASVGLIPWLSSFAVFLTKRDLDQVRMTIAQTKLPVKLGAGYSGILTGFT
GKTHQSVEDIAIYRAMPNMTVIAPADEVECRQAIYAATYHPGPVYFRLTRDPGPVIFDDT
YKFELGKGIVLRQGRDVAIISTGVQTTRALEAAYILESQGISVYLLHLPTIKPLDTEAIL
ATAEATNRVVTAEEHSILGGLGGAVAEVLGEKRPTRIVRVGLRDVFGESGPNDALLEKYG
LTPQHIVAAATGLLEGRDA
Download sequence
Identical sequences D1CCB8
gi|269926632|ref|YP_003323255.1| WP_012875467.1.85100 525904.Tter_1527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]