SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926663|ref|YP_003323286.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926663|ref|YP_003323286.1|
Domain Number 1 Region: 303-462
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.37e-29
Family HD domain 0.029
Further Details:      
 
Domain Number 2 Region: 200-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.85e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926663|ref|YP_003323286.1|
Sequence length 509
Comment RNA binding metal dependent phosphohydrolase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MPDALTFVIAGIALVVGAGASYLYLRFISNNQIREAERLRDRISEEAATKQKQILLEAQA
EAIRIRNEAEAEVKERRADLARAERRLQQKEENLDRKIEALERREQKIQARDQESERIRN
ELEKIKQEQMLVLQQRAEMTKEEAKAELLRQVEAEAREDAARIIRQIESEAKEEAERRAQ
MIVAYAIQRIGTEYASEVSVSTVPLPNEDMKGRIIGKEGRNIRAFEEATGVDVIIDDTPE
VVTLSAFDPIRREVARRALTKLISDGRIHPARIEELVSKAQQEVEAEIKEAGEQAAMEAG
VQGLHPELIRLLGRLKYRTSYGQNQLRHAVETSLIAAALAAELGADVNVAKTAGLLHDIG
KAVSHEVEGPHALIGAEIARRLGRSPKIVHAIAAHHEEEEPQTVEAVIVAAADAISGSRP
GARRESVEQYIKRLQALEEVANSFEGVEKSYAIQAGREIRIIVKPDHVDDLEAAKLARNV
VRKIEESLSYPGQIKVTVIRETRNVEYAR
Download sequence
Identical sequences D1CCE9
525904.Tter_1558 WP_012875498.1.85100 gi|269926663|ref|YP_003323286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]