SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926664|ref|YP_003323287.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926664|ref|YP_003323287.1|
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily IpsF-like 1.83e-59
Family IpsF-like 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926664|ref|YP_003323287.1|
Sequence length 159
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Thermobaculum terrenum ATCC BAA-798]
Sequence
MRSGIGFDAHRFVVGRKLVIGGVAIPHHMGLEGHSDADVLTHAIIDALLGAASMGDIGTL
FSSDDPDLAGVDSTKLLAKVCEYVRGAGWDIDHVDSTIIAQAPRMSPYIGAMRDKISKVM
EIPLTSVSIKATTTDGLGPWGREEGIAALAVCNISRKDE
Download sequence
Identical sequences D1CCF0
525904.Tter_1559 WP_012875499.1.85100 gi|269926664|ref|YP_003323287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]