SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269926004|ref|YP_003322627.1| from Thermobaculum terrenum ATCC BAA-798

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269926004|ref|YP_003322627.1|
Domain Number 1 Region: 5-263
Classification Level Classification E-value
Superfamily Cgl1923-like 4.58e-75
Family Cgl1923-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269926004|ref|YP_003322627.1|
Sequence length 311
Comment hypothetical protein Tter_0888 [Thermobaculum terrenum ATCC BAA-798]
Sequence
MEEIRAESWPNLANPTMIAAYKGWNDAGNAATYALEYIISQTGATMFASIDPDEFYDFTQ
VRPYTRPIGDYGRVITWTPNNFYYAHISESKDYVFFVGTEPNLRWRRYSSLLVKMANRLG
VKEVISLGSMLADTPHTRPVPLSGGASSPELGEKLRSLGINSSFYEGPTGIVSVAGLTLA
ESGIQHASIWASVPHYISASPNPKAALALVDSVERLTGLRVSVDRLQMEAITFESQVDAA
VSDNPDIEQYVRELEQRVEDQQNEDTQDEGTPEGYDASEAEGLIRSIEEYLRQQSQNRNK
DDEEDQEEDNK
Download sequence
Identical sequences D1CFU9
WP_012874840.1.85100 525904.Tter_0888 gi|269926004|ref|YP_003322627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]