SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284047706|ref|YP_003398045.1| from Acidaminococcus fermentans DSM 20731

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284047706|ref|YP_003398045.1|
Domain Number 1 Region: 176-252
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000000000116
Family TonB 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284047706|ref|YP_003398045.1|
Sequence length 256
Comment TonB family protein [Acidaminococcus fermentans DSM 20731]
Sequence
MAKPEWNRYFSLSLLAHLLILSLGGALLYAHRSLPETPQESIRVHLAGPDRGRGNAGTPG
KGKDSAAQQGNGTAHAGTGEQDRLLEQLMEAPSRVNDRGEVERPERNGAQESGGEQAGVS
PSSGGSGETGGSGNLAGNGQGNGSGGPGAGDGSGASQGGGESLEDRSRDASLESYSKIYP
QAARASGEEGTAQVGVEISAGGEVLSAWLESSTGYDRLDRAALKSARQWTFSPALDAAGH
PVPSRKSVTVVYFLTE
Download sequence
Identical sequences D2RNV4
gi|284047706|ref|YP_003398045.1| WP_012937720.1.22703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]