SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269797129|ref|YP_003311029.1| from Veillonella parvula DSM 2008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269797129|ref|YP_003311029.1|
Domain Number 1 Region: 159-244
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0000000000759
Family TolA 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269797129|ref|YP_003311029.1|
Sequence length 249
Comment TonB family protein [Veillonella parvula DSM 2008]
Sequence
MVDKRYGIPFVAALVLNLVYWGVVGDWFSHIKPPETQKKDLVINLDMGQQEPPQEKKDPE
KLKIHPDDKPVAGGGKAGSVLPDLSGKPTEGLKNLNPYLGGNETASVNLNGNTDNPVGNL
GSGNVPGPGGGNAGNGGLSEEGNGSKGGDPGPGDVERRGGSYDSSGYIARVESNKVMPQQ
AVRRGLSGRVSFEITFDADGNFAGANMIGSSGSSILDNAASSLVESSGGIENTTGEPVTI
VVNVDYGYN
Download sequence
Identical sequences D1BQD6
gi|269797129|ref|YP_003311029.1| 479436.Vpar_0060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]