SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269797271|ref|YP_003311171.1| from Veillonella parvula DSM 2008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269797271|ref|YP_003311171.1|
Domain Number 1 Region: 54-105
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00000000000392
Family TonB 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269797271|ref|YP_003311171.1|
Sequence length 125
Comment TonB family protein [Veillonella parvula DSM 2008]
Sequence
MNKLFRYAAAAVLVASFGMLSDYTADAAKFLESPREVTIVKPELPEIPQTATVAPDMRVR
FLIDKKGNVKNVFVERSSGYAPVDEAVKKAILQWKFTPAIGTDQKAHESIIGMTITLPKQ
AVKAK
Download sequence
Identical sequences D1BQS8
479436.Vpar_0204 WP_012863799.1.68909 gi|269797271|ref|YP_003311171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]