SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269798753|ref|YP_003312653.1| from Veillonella parvula DSM 2008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269798753|ref|YP_003312653.1|
Domain Number 1 Region: 174-266
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000000641
Family TonB 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269798753|ref|YP_003312653.1|
Sequence length 267
Comment TonB family protein [Veillonella parvula DSM 2008]
Sequence
MPKKYVDVWKYPHMTYKKAFAIATIISVVAVGAAFVSFSDYIESQMTGSLQINFLTEQEA
EKQVEEIKEQIKEEKVHELQYQKELENNKVQPDNGGAGHGGQNGNSAVPTKSDVSTSSQQ
ARAGETGTIKQSSVGSNTGSGLVGPEGPGIGYASTGSGEGLSDREGTGGTEVDVGGGGTF
SYDGYWSNLQSAINSNYPTDAYAMGIQGDVTLRIYFAPGGSVASVEVLNSDDPILTEHAR
EYAYSVGGAENSTGIQQYADITIHYNL
Download sequence
Identical sequences D1BPR6
479436.Vpar_1697 gi|269798753|ref|YP_003312653.1| WP_012864911.1.68909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]