SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269140611|ref|YP_003297312.1| from Edwardsiella tarda EIB202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269140611|ref|YP_003297312.1|
Domain Number 1 Region: 6-217
Classification Level Classification E-value
Superfamily HAD-like 3.31e-43
Family YihX-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269140611|ref|YP_003297312.1|
Sequence length 233
Comment hypothetical protein ETAE_3270 [Edwardsiella tarda EIB202]
Sequence
MVPTLDWNDIDTVLLDMDGTLIDLAFDNYFWLTLVPQTLSEARGISRADAQALIQREYQA
VAHTLNWYCFDYWRERLGLDIHRMTLEQGTRVQVRQDTLPFLNALRASGRRTILLTNAHP
HGLAMKMAQTGLDSHLDILYSTHRFGYPKEDQRLWRAVQHQCGLDPARTLFIDDAEPILD
AAHQFGIRYCLGVSNPDSGRPEKRFARHPAMSDYRALLPAIVAGRPDTDRRAP
Download sequence
Identical sequences A0A0H3DU71 A0A1D7VCH9 D0ZG03
498217.ETAE_3270 WP_012850070.1.32191 WP_012850070.1.79796 WP_012850070.1.83294 WP_012850070.1.91532 WP_012850070.1.93598 gi|387869085|ref|YP_005700554.1| gi|269140611|ref|YP_003297312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]