SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269140832|ref|YP_003297533.1| from Edwardsiella tarda EIB202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269140832|ref|YP_003297533.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily HAD-like 8.27e-41
Family YihX-like 0.000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269140832|ref|YP_003297533.1|
Sequence length 195
Comment phosphatase [Edwardsiella tarda EIB202]
Sequence
MLYIFDLGNVIVDIDFHRVLGVWSRYSGAPLATLSKRFTMGDTFRQHERGAIDDETFAQR
LCDEMGISLSFAQFELGWQAIFVALRPEVIDIMQRLRRQGERVVVLSNTNRLHTHFWPKH
YPEIAAACDKMYLSQELGMRKPDAEIYRYVLEQERAAAGESVFFDDNADNVAAAKALGIQ
AVQVCDRQVIPAYFA
Download sequence
Identical sequences A0A0H3DXI3 A0A1D7VD25 D0ZHC9
gi|269140832|ref|YP_003297533.1| WP_012850285.1.32191 WP_012850285.1.39507 WP_012850285.1.79796 WP_012850285.1.82304 WP_012850285.1.83294 WP_012850285.1.91532 WP_012850285.1.93403 WP_012850285.1.93598 gi|387869279|ref|YP_005700748.1| gi|470464526|ref|YP_007630837.1| 498217.ETAE_3491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]