SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284042096|ref|YP_003392436.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284042096|ref|YP_003392436.1|
Domain Number 1 Region: 149-318
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.62e-54
Family Aminoacid dehydrogenases 0.0000119
Further Details:      
 
Domain Number 2 Region: 316-545
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.76e-50
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000459
Further Details:      
 
Domain Number 3 Region: 14-133
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.68e-20
Family GntR ligand-binding domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284042096|ref|YP_003392436.1|
Sequence length 547
Comment Glu/Leu/Phe/Val dehydrogenase [Conexibacter woesei DSM 14684]
Sequence
MTEAFEGREAGIGIRLAVEAEAVRRLATEARGLTALGPAIDRIDEAARLRDRVALAEAEL
EFHTNLVELAGDRFLTADYRAMGDRLQRIFSDDGRSLSTLDGLADMHRALVRAIASGEPD
AAVREMRAHVLDEERLAGPADPWLDAVARGRLAGAAAGVEHAVLERLLAPDRCVEVHVSA
QLADGTTAIVTGWRVQHDLAVGPAKGGTRLHPSTTLAEVKALAMTMTWKCALVGLPFGGG
KGGIRIDPARMDERGRRRLIRDYVTLLAPVLGPERDIIAPDVNSGEREMAWAVDRLEALS
GRSMPNAVTGKPVALGGLAGRRAATGHGVAAVLRRFASARWGREAGPLRVAIAGFGNVGQ
HLAEALDGDPGFRVVAVSDAAGARYDERGLAVDALRAAVARDGTVAGAPTGRPMERDAVL
AAPCDVLVPAAVGGVIDADAADAVQASLIVEAANGPVTAAGERRLAARDVTVVPDLLANA
GGVIASYFEWRRLHEGDRELARRRDALLAEACDRVIERAPDLADLRQASLQLAIDRAAAA
HLARGAG
Download sequence
Identical sequences D3F994
gi|284042096|ref|YP_003392436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]