SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284042408|ref|YP_003392748.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284042408|ref|YP_003392748.1|
Domain Number 1 Region: 105-231
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.94e-27
Family GntR ligand-binding domain-like 0.0063
Further Details:      
 
Domain Number 2 Region: 12-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000213
Family GntR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284042408|ref|YP_003392748.1|
Sequence length 239
Comment GntR family transcriptional regulator [Conexibacter woesei DSM 14684]
Sequence
MGMAGPDIKIQKLGDQILRIIVTRIVNGELAPGDSAPSEFEICGEFGVSKTVAREMMGTL
VNKRLVLVRQGRKPEVRPAAEWDVFDPLILELQQDERVVAQIVSQMQDVRTILEPEIAAR
AAADITDEQLAQVRAAYERMLALAGSPDRFLADVEFHVALAAATDNRILTHIMESMRDLM
RVSVRQRAGLDTRVFESGGRDVHKEILEALEARDPDAARDAMRAHMLLAKRARADRSTR
Download sequence
Identical sequences D3FBK4
gi|284042408|ref|YP_003392748.1| WP_012932426.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]