SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284043210|ref|YP_003393550.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284043210|ref|YP_003393550.1|
Domain Number 1 Region: 238-442
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-27
Family Pentraxin (pentaxin) 0.087
Further Details:      
 
Domain Number 2 Region: 754-1006
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.2e-17
Family YfcE-like 0.053
Further Details:      
 
Weak hits

Sequence:  gi|284043210|ref|YP_003393550.1|
Domain Number - Region: 5-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0831
Family Leech intramolecular trans-sialidase, N-terminal domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284043210|ref|YP_003393550.1|
Sequence length 1298
Comment LamG domain-containing protein [Conexibacter woesei DSM 14684]
Sequence
MPIRRFDGVDDFVTLSIGAAGVTRAVTLAFLLRSRAQAPGVDRALGGAHDASGIPLGFHA
EVIGSNGVGFVAGEWATATYGGGGFAAADEWRLLVLTKAAGSVAATFHSYDFAARVLHTS
VHGVVGDAAATTGGTYTLGMLYPPGPGDCWGGELAAHAVWASELDAAAVRSLATAPSLTS
WLEIGRPAALWLLDQPTPAAPIRDLTGNGADQVAIVGTTVLDEDPPIPYRPTYVSEVTAD
APAAWIRLGETRGTSAADAVGGTSGTYVGSCTLGVPGLVRGDADRAVRLDGAGHVSFADR
PAFDLTTRGTIEAWVRVDTADAAFRPIVDKGEGSYIVRFDDTGRLIFRRNSVQDICKAVV
PLRQGVTTHVVVTWDASAPFVRIYFDGVDVSGPASWSPLQATSTPLTIGADDAGSHWVGA
LDEVAIYPTALSRARVQAHHAAGIARRQHATAYSSPAVTSLAVSLARTAAASALLVSAIS
VNKSAGSVPRPSTGWTLIAGDDGMASGFGQVALAMAYRIADGTSADVCGWTWTTADNAAG
WIAEYAVGELGDVEHAATWSTTERVRALTVGPVMAQEGALAVAHLAVDTWYNWDPPDDGV
YASWSDSFAAADRAFVPEDVGGAFADRVVHAAGPVSTTVTSLGGEGDQSAGILVVFGAGT
PPTPAVLTQWCGGVTSAAAEVVYTVDRGAIGRLALSTTPDLSSAFYSEPETVDAQRVLRL
PVSGLSADTSYYYGVEVDGTLLLTGRGTFRTMATEPASFRVAFGSCAHPSFGVSPTHRRI
VASGAQVMIQSGDLGYPDEIGPMTVAGLRASYDTVGSTTGIDAVMRAMPVVHVWDDHDST
GEAGGTATAAAQVYREREPHYALADPVAIHQTWTCGRVRFVVLDCRSQRDPLADPDDDQK
SALGAAQRVWLDGVMRTATEPVIVVISSVPWNDPRRLDGDAWGRYSTERAALIASWRAAG
VLDRILMVSGDAHMLAADDGTNSPGGIPAVQAAPLGHHSGSRKGGTFSEGTHLGSAQYGL
LTVTDNGGETISVTFDGRGADDATVIEMTTVYAVSRDPDGGGQPRPVEPRPPPMGSCGAE
LYAAVGPLAYEDHLQDWALAHLCEAIGRMRQSVSDIVRDSERTELVDGEEVVVELPGWSL
ATDVDWAPGAASEIDMLPFVGQLAGVRGIERLSDDDRRAAIRGREGFWRGGPRAILSYAE
SFTDGTPGAVRLRERYDPNQPSGTDAPYHGRVIVKRSRLKPGVDEAELRLRLLGRIPAGL
IYDVLITDELDYDDVASTYVDYDEVAARTTDYTDLLEG
Download sequence
Identical sequences D3F200
WP_012933226.1.44340 gi|284043210|ref|YP_003393550.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]