SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284043822|ref|YP_003394162.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284043822|ref|YP_003394162.1|
Domain Number 1 Region: 38-573
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.71e-136
Family Arylsulfatase 0.000000664
Further Details:      
 
Weak hits

Sequence:  gi|284043822|ref|YP_003394162.1|
Domain Number - Region: 633-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000121
Family Laminin G-like module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284043822|ref|YP_003394162.1|
Sequence length 783
Comment sulfatase [Conexibacter woesei DSM 14684]
Sequence
MSLTEYTAGTVFPGVIGRTADESTPAWPAPARAERGSPNVLTVVLDDTGFGQLGCYGSPI
RTPNLDRVAAAGVRFSNMHTTALCSPSRSCILTGRNHHSNGMAAITELATGYPGYNGNIP
FENGFLSETLAEHGYSTYMIGKWHLIPSSQETGAGPYDRWPLGRGYQRFYGFLGGDTSQW
EPDLTYDNHQVEPPRTAAEGYHLTADLADKSIQFIADAKQVDPDKPFHLHFCPGATHAPH
HVPKAWADGYAGAFDDGWDAYREQVFARQVELGIVPADAELSRHDPDVPEWGALTDDQRR
LYSRMMEVFAGFLEHTDHHIGRVLDFLESIGELDNTIVMVVSDNGASAEGGLTGTTNEAQ
FFNNAPEPFEDSLAAIDELGGPRHFNHYPWGWTWAGNTPFRRWKRETYRGGTSDPFIVAW
PQGIAARGEVRTQYAHIIDMVPTILELVGIDAPKTIRGVTQSPLHGVSFAHALADPGADS
RRRTQYFEMLGHRAIYHDGWRAVCPWPGPSFAEAEQAFGDPISEHQLAQLDQSGWELYHV
AVDFAENHDVAADNRERLIALIGTWYAEAGKYDVLPVDGSAVARMVSEKPLVAAPRDTFT
YYPNTQSVPFFAAPRVLNRPHSITADVEIPDGGAEGVLLCQGTSAGGYSFYLRDGRLHYV
HNWVARELFRVSSPDAIPAGRHELRFEFEPTGAPDIAAGRGAPGLFQLYVDGTLVAETEA
PYTTAIVFNPGQLTCGADPGSTVVADYPAPFRFSGTLHTVKVDLSGHLITDEEAELRMAL
ARQ
Download sequence
Identical sequences D3F6M0
gi|284043822|ref|YP_003394162.1| WP_012933838.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]