SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284045137|ref|YP_003395477.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045137|ref|YP_003395477.1|
Domain Number 1 Region: 79-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000458
Family NfeD domain-like 0.007
Further Details:      
 
Weak hits

Sequence:  gi|284045137|ref|YP_003395477.1|
Domain Number - Region: 19-67
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0445
Family Proton glutamate symport protein 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284045137|ref|YP_003395477.1|
Sequence length 143
Comment hypothetical protein Cwoe_3685 [Conexibacter woesei DSM 14684]
Sequence
MDAWVIWIIVACAFGVGEIVTTSFFLAPFGIGAIAAAIVAAVGGGAFVAGAAFILVSVLM
LLFVRPIARAHLNSPAQIRTGTAALIGRRAMVMERISNDEAVGCVRIDGEIWTARAYDDD
EIIEAGRPVTVVEIRGATALVAE
Download sequence
Identical sequences D3F1D9
WP_012935153.1.44340 gi|284045137|ref|YP_003395477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]