SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284045443|ref|YP_003395783.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045443|ref|YP_003395783.1|
Domain Number 1 Region: 152-333,378-515
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.31e-16
Family Cellulases catalytic domain 0.021
Further Details:      
 
Domain Number 2 Region: 29-123
Classification Level Classification E-value
Superfamily E set domains 0.00000000000574
Family E-set domains of sugar-utilizing enzymes 0.005
Further Details:      
 
Domain Number 3 Region: 922-1041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000779
Family Alginate lyase 0.038
Further Details:      
 
Weak hits

Sequence:  gi|284045443|ref|YP_003395783.1|
Domain Number - Region: 1069-1190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0116
Family Alginate lyase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284045443|ref|YP_003395783.1|
Sequence length 1217
Comment hypothetical protein Cwoe_3991 [Conexibacter woesei DSM 14684]
Sequence
MRNQLHKTAGFLAAVVLASLAMWTASAQAVINPADFSILEAQIGYKSDETKRAFIVSTNP
TTDRLGTFQLRNATTDATVFTGNVTYWGQKWGEAYWTMDFSSFKTAGSYYIDVPSLSKQS
DRFSLQADLFRTQTLLKTSVDQLEPRIRGKLGWQDCGTDLRGVEGHATLLYGLIDAYEAY
GDRLSATDEGRFLDQMRHGADYMVACQKPNGSFCSEYYFYPNIVTWHKSLLATIALLQVY
EVTRDAGYLRAAQAGWDWAMSRPEFTKLETAAEVGDTRQVYGQRSPWLPPQELRTRDKLL
LVWGATEFFRVTRDTAFKTIALNYADQVYDNQFLDYTNAVEGMYGNFYAWTNEEIFQKSW
EHGAWYYNNGAVLPDHILGLVKLVEQFPNDPNWLKWRYILRVYKDRFLKPTHDLSPFGIY
PLGMYDREVRFFGPTWHGTNGMYGNIAKNAMLLARMFDDVELQEIADANMQWVGGLNAGT
MLGGKRQSISMIDAVGTHYVPTWSGIDGSIANGLSATPQFTLDYPEPLMDAPVTFTHEDW
IVHSGGWLSGLSEVERAPVVRVVTKNAGAAVSASVRVDLDTTTTHSTNASGELTLSTLPR
GQRGTISATYGGRTVTRDLSTIAGEDRTFQVDFADSLAVTVTADPATLAGTVSVTNDGSA
SATVSGTLAAVGATLSSGTFSGRVASGATQRFAFTFADDDPQKIQPFLIRATAQGPYSAA
SAETVGELPVSYTPNTTFSNHDFESGNLSGWTVTSGTAFGAGAVVNANTAVGGSNEPFNK
QGDYLLWGHKLAGDGAVGELRSPTFTIAPGDARLKVGGGNDAANLYVAVVDVASGTVLEK
ATGTNAEKMRWVVWDMTKYAGRQAYVRIYDGATGGWGHINADDVNVPVYSSGFSSNLKRL
TSHGDASTWTTGTNGLTGTSTDAVRMSSRSGSNFTYETDVTLTTARSGALVFRSAPNPYT
GGGYFVSVDRVEGKVKLFKVNPYTLIASATKTIAANTTYHLKVVTKNQRIKVYFNGESSP
SIDVTDSSYASGRFGIGVYNDGRSGAARFNHTVQSPSTGFETTLGSFSATGNSTSWTEQP
AGLTGDAEDGVYVSSTTGTNFTYQADIRLDTAQAAGLVFRSGANPFSASYIANFDREEGK
VKLFKLAPGYTLLGSANRTIQLGTSYRLRVVVSGSSMSVYFDNEASPAVTVTDSAFASGR
FGLSTYRGIATFNHVTH
Download sequence
Identical sequences D3F3P3
WP_012935459.1.44340 gi|284045443|ref|YP_003395783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]