SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284045763|ref|YP_003396103.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045763|ref|YP_003396103.1|
Domain Number 1 Region: 106-239
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.06e-16
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 39-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000442
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284045763|ref|YP_003396103.1|
Sequence length 243
Comment GntR family transcriptional regulator [Conexibacter woesei DSM 14684]
Sequence
MSREPTDPTTSLNLGRHAAMPGGMAGQHAVKLERSIYSGRVASILREAIVEGSLEAGSPL
VEARLAAQLAVSRGPVRNALHVLEGEGLVRTQPNGRSIVVGFSAADLDDLVSVRLELEST
AIQRGVAARNDTAPLRAAYELVHAEGASTQRLVDLDIDFHRALLEFSGSRFLTQAWLALA
PVIHTVITIGNRRMAEADPDENFTRILSVHEPLVKAIERYDARRALRLLGEQFSVTREMF
AGR
Download sequence
Identical sequences D3F6T0
WP_012935779.1.44340 gi|284045763|ref|YP_003396103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]