SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284045946|ref|YP_003396286.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045946|ref|YP_003396286.1|
Domain Number 1 Region: 868-944
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000455
Family Cadherin 0.037
Further Details:      
 
Domain Number 2 Region: 507-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000377
Family Dystroglycan, N-terminal domain 0.071
Further Details:      
 
Domain Number 3 Region: 595-679
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000173
Family Dystroglycan, N-terminal domain 0.028
Further Details:      
 
Domain Number 4 Region: 782-855
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000314
Family Cadherin 0.047
Further Details:      
 
Domain Number 5 Region: 684-766
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000612
Family Cadherin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284045946|ref|YP_003396286.1|
Sequence length 1232
Comment Ig family protein [Conexibacter woesei DSM 14684]
Sequence
MTRHGRLSLPLPRAVAAAALCALLALLIATLGAERAAAAPAGAAVCTAADCPSTGAPQQL
TFSAPAASAGERSRGPALLARPARLHVAVSGVPAGRTATVVVTSPRGRRWRIARTRTFRP
RVPGRWTVTGQRIVREDVTLFPKHRSSVVQVRRGGRGTIRVAYVQSVANETAVAPARAIK
SFERDGGRLVLTVADPQRKIAAGGVVAAGVSEATPQGALIAVSSVRRSGTTAVVTGTQAP
LSAIGPQARITVRPELTLGQDGLARASAAQPGAVEKPYKCSGGVSASINGSVGLDAGAEI
GISWGGFWHPLTVKAIAAARLRQSAQLSLVVAGKAKCELDVDLLKRDIRYSPITFTVGPV
PVVITPKLNFRVFAEGSVQGAVETSVRQSLDARVGLEWDGDDLIPIKSVTNRTSFTPPKP
QFDASIEAGLGPRLMFDVYEVGGPYITGDALARFDVSSHKNPWWRLSAGFQAGAGIKFKV
WKFTFNRHKPDLLSKLWTLAEAKGAAPPSVTQETLPGAVAGTPYRTTLTVTRGTKPIAWS
VSAGTLPAGLTLNPSSGLISGTPAATGTASFTVKATDAQKQVATRALKLAVAAPAPSIAP
ASLPAATLGAPYRAQVTGTGSTTPYAWSVSAGALPAGLSLDPRSGLISGVPSATGTASFT
VALSGGDGQRATRAYAVKVEAAPLSIPQQTLPGATVDAAYTASLSAEGGVAPHRWAVTAG
ALPAGLTLADDGRLTGTPTAPVSATFTVTVTDADGTSASRELTLTAAYPALSVPQQALLA
PMAGQAYSAQLRADGGGAPLTWSVSAGAPPAGLSLAGDGTLAGTPTTVGPSTFTVTVLDR
YGQEAERELTLTVVPNAVEVVTATLPGARVGTAYAQTLDGRGGRAPYTWSLAAGSSLPTG
LTLDPSTGAISGTPTTAGSRTFTVRVADADGVTATRSLSIAVAGNTPQDLRSVACPTDTF
CMVGDLGGGIVTFDGTSWGDREVVVPGDIAQRISCATATDCLVVTWNGRTKVWSGGTWTS
GPDVPSEEFSNALSCITATNCFLGGQAAGARAAVWHWDGSSWTAPDDAVGAGRAVSGVSC
PTATFCAAAIGNVHTVSFWNGATWETPVSPGIFNGSSLGCTADRRCVLTDATGQGAFYSG
GTWSSRRIGSGSNDPAPVGCSRTASFCAYAFSGDGGSLFTWGATSTEAAGRGRDVAAVAC
SSADLCVAVGPGGVAQRWDGTSWVDEGVIAAG
Download sequence
Identical sequences D3F817
gi|284045946|ref|YP_003396286.1| WP_012935962.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]