SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284046426|ref|YP_003396766.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284046426|ref|YP_003396766.1|
Domain Number 1 Region: 83-163
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000922
Family Tetracyclin repressor-like, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000012
Family Tetracyclin repressor-like, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284046426|ref|YP_003396766.1|
Sequence length 190
Comment TetR family transcriptional regulator [Conexibacter woesei DSM 14684]
Sequence
MAATDHRRATAERNVSAILDAVERLLARSATVTIAAVAAESGVSRVTVYAHFDSVAALLE
AVVRRAVKGALAALAAADPASGPARDALDRVVDASWQVLDRHSGMARTAAELLSAERLRA
SHEQAMVPVRELIERGRAEGAFRTDLPADWLVTVFYALLHATGDDVRAGRIDQASAAAVL
RTTLHSVLAG
Download sequence
Identical sequences D3FC96
WP_012936442.1.44340 gi|284046426|ref|YP_003396766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]