SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284046750|ref|YP_003397090.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284046750|ref|YP_003397090.1|
Domain Number - Region: 143-190,221-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00136
Family Laminin G-like module 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284046750|ref|YP_003397090.1|
Sequence length 313
Comment hypothetical protein Cwoe_5309 [Conexibacter woesei DSM 14684]
Sequence
MGILAALWIALAAVGVWPQTIATDPPVAQTSADTRAASCAQISSATWRSTFADGTFGEWS
ASDVPGNGGGLTVTTPGRAGIAPSLPCTGGRIAEFRVTAASLRRGDVHAKVYKGWDVGPG
PGRRDDGDRPLSRLVPGEEGGVYSAWYYIPRSYKIARGPVNIFQFKEDTSNDGGITLGRS
DMQSSVSIFSARGFRGLASRTGVVQRPLGRQTRIKDSTPVLGVDVWHPARPRHARGMVPA
PLGRWFNVTAVVRPRDRVAYYVDGSLLDVWTDREYPVGIRYPNAMGWTFGVGHYGGNVGR
LWVAGVSVTLRAR
Download sequence
Identical sequences D3FFC2
WP_012936766.1.44340 gi|284046750|ref|YP_003397090.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]