SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284047099|ref|YP_003397439.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284047099|ref|YP_003397439.1|
Domain Number 1 Region: 225-498
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.23e-29
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0036
Further Details:      
 
Domain Number 2 Region: 33-258
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.49e-27
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 
Domain Number 3 Region: 478-629
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 6.28e-19
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284047099|ref|YP_003397439.1|
Sequence length 742
Comment hypothetical protein Cwoe_5660 [Conexibacter woesei DSM 14684]
Sequence
MFLKRALTASLLAAALAAPASASANVQVGSSGWEWGNPLPQGNTLRATSFAGTTGYAVGD
FGTLLKTTDGGGTWSGLRVSTFAPLTIVQTLDANTVLAGGGCVARRSTDGGRTFTSIAFT
PVETSCRASLTDMSFASPTVGFLLLSDGSVFSTDDGGTQFTPRTAVPGTAAAGGSVAPAS
VAFTGPATGFAATTDGRIFATTDGAVSWRVVAETGRAIRQLSFADPAHGFAVGQNGLFAR
TVDGGQRWTPKDLGAGALDYTAIRCANAELCVLSTATGAQLVRTSDAGETAGAVITPSTD
PIYAAAFASPTRIAAVGASGSTVVSDDAGTTFRAIGGRLTGSYGAVYDGAARGSAFALGE
AGALAKTLDGGRTWTRGNVPTTAGLRHVSFPTTSVGYALDDDGGLFRTANGGTSWKTLGT
GSAARPAAVHAPSESTLLAIGPRGVRRSTDGGETFSPVRARAISRAALYGAAAPRGAIVA
WGPTTFARSRDGGRTWTTLRKPGGTRRARSGMRIALVAFSSADAALLLDRAGTVWRTTNG
GRTWSTLPAIGTSAIDGLVVDDDRTAYVVPRRFGEVEGGYLLRTTDGGATWQPQLVVREA
INGIATSGSATDYLLGGSSQLLSSTTGGSAGRRSTLTLATSRRTLRKPAPVTVTGRLRPA
GPAARVTVSMREPGGRWRSQTVDVASNGTFASRWRVARGTTTFVAQWSGDFTSAGAGSRV
LTVTARAPPRRSGGRGRRGRRG
Download sequence
Identical sequences D3F1N3
WP_012937115.1.44340 gi|284047099|ref|YP_003397439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]