SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291287514|ref|YP_003504330.1| from Denitrovibrio acetiphilus DSM 12809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291287514|ref|YP_003504330.1|
Domain Number 1 Region: 142-222
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.14e-24
Family TonB 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291287514|ref|YP_003504330.1|
Sequence length 224
Comment TonB family protein [Denitrovibrio acetiphilus DSM 12809]
Sequence
MKKHLNGSITLFSAVVLAVLINLLIFIGIPFLSAATAGKPGDIIDSFVSFSMEKPMKRQD
EEIEKKREEEKKPEKLPEMNLKHTAHKLTRPKLDVSLPDLSFDINASLSDGVAVSVPAGG
GSFAGGVKLNFDIGEVDTPPSIVYKTDPVYPFTAKRRQVTGKVILKFLVKSSGEVSDMQI
VSSEPEGVFDEAVRNAIARWRFKPGIYDGKPVNTWVVAPFEFRM
Download sequence
Identical sequences D4H8M5
gi|291287514|ref|YP_003504330.1| WP_013010888.1.70151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]