SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291288771|ref|YP_003505587.1| from Denitrovibrio acetiphilus DSM 12809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291288771|ref|YP_003505587.1|
Domain Number 1 Region: 441-609
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-40
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 629-748
Classification Level Classification E-value
Superfamily CheY-like 1.18e-27
Family CheY-related 0.0015
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000133
Family Heme-binding PAS domain 0.07
Further Details:      
 
Domain Number 4 Region: 145-247
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000785
Family Heme-binding PAS domain 0.076
Further Details:      
 
Domain Number 5 Region: 380-449
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000143
Family Homodimeric domain of signal transducing histidine kinase 0.0091
Further Details:      
 
Domain Number 6 Region: 9-153
Classification Level Classification E-value
Superfamily CheY-like 0.0000228
Family CheY-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291288771|ref|YP_003505587.1|
Sequence length 750
Comment PAS/PAC sensor hybrid histidine kinase [Denitrovibrio acetiphilus DSM 12809]
Sequence
MSPEKVKHILFLTENRKLKEAVVSYLRSQKILIKIKLCEGYSCLEREVKAGNISMCFADY
KLGHNLIVKAIDAQKSIDSDLPFIIITEKDKQDAAAELLAVGADDYITLDNMKRLAPVIR
RETKAYEEVQAGKKARQEIKELMNIVQSAEDEVYVLGGESHKIKFANKKALSNLGYDMQE
LDGKNIHDITEEGLPLKAEEREAQGRVMLHTRFIRKDGTKYPAEAIFQTAETEGGTAILV
IVHDSTEKESAKQHAFVLNKAIDASASAVTVTDSDFCIIYLNKKQITTAGNSKAFMIGKD
ITEQKMYESSGKEFFNALDRCRRGESWVGEYQKTGHNGEEYIVLGSMSPVYSDLNTVTNI
VIVEEDITERVRIKSQLLHAQKMETVGELTSGIAHDFTNMLTAIGGFSSIMKRKMDKDSR
FYVYAEKISELTVRARELTKNLLTFSRKQMEAERAVSVNTLVKSVGEFLTMVIGSRIELE
LKLMEEDINIMGDPVQLEQVIINLATNARDAIEAEGKLVITTDKTMVSDEKSAGGFAEYA
VISVKDNGCGIDQKTLDKIFEPFYTTKQAGKGTGLGLYIVTDIITRHHGYIECFSEPGQG
TEFVIKLPVTDQTPEAACAEAEIEDSSENITILLVEDEKIVRESLSHALDVYGYKVYEAV
NGKEAVEIFKQRSFEIDMVISDIVMPVMNGITAYKEMIAIKPGQKFIFTTGYVGEAHRKE
GFDEEDHVVMIKPLMLKELVRKIEELLREN
Download sequence
Identical sequences D4H6F7
WP_013012118.1.70151 gi|291288771|ref|YP_003505587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]