SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289164734|ref|YP_003454872.1| from Legionella longbeachae NSW150

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289164734|ref|YP_003454872.1|
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Sec7 domain 6.54e-50
Family Sec7 domain 0.000000805
Further Details:      
 
Domain Number 2 Region: 200-350
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 8.5e-47
Family RalF, C-terminal domain 0.00000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289164734|ref|YP_003454872.1|
Sequence length 384
Comment RalF protein, translocated into host cells by the Dot/Icm system [Legionella longbeachae NSW150]
Sequence
MINPELEKAQNEIITSFNSDPKKGIQLIKNICSTHGIDSAEQIADFFHRQKHKLDLDAVS
DYLSKPDEESKKVLQNFTSQINFREQSFTEGFRVFLNTIKLPSEAQKIDRLVQSFGETYY
QQNYENHIANKDAAYTLAYAVLILNTSLHNPNSRQKDKLTLSALKICLKGLNDGQDFEDA
FLKKIYEEIKCKPFEFNLAKTTPGYLLTSSTLDDDLMFKKLDLLLQSSISTTEEIFPEIA
DNITVTFDKPKAWLKAFIGYEGTIKFTTESGRELANIQIYKPSLVSKWLFGAQPKVIIQP
IDQDENPKEAIELAAKIAVLFESPVNSFKATYDYELSELISAYDQQHKELVRKPFIPQFE
KLRFFQRPCSEDNKEELMKSNGLK
Download sequence
Identical sequences D3HS78
gi|289164734|ref|YP_003454872.1| WP_003631848.1.28247 WP_003631848.1.41439 WP_003631848.1.55568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]