SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289165820|ref|YP_003455958.1| from Legionella longbeachae NSW150

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|289165820|ref|YP_003455958.1|
Domain Number - Region: 112-248
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0785
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289165820|ref|YP_003455958.1|
Sequence length 271
Comment hypothetical protein LLO_2499 [Legionella longbeachae NSW150]
Sequence
MNDIKIEQLQSLVDAAKKNIESSEKILDELCEDSKPAEVSFMEDTVYSIQLVLQYRFSCQ
DALAILFQLDQNLLYLLGIQPQHTAKMNFDRLAYALGNDDLKQMIHALSLLVSALLKITN
HYQKGHVQFGLKSNKPVKQNSIIKGMQKLISLNNHFISIIQQLQNNVKLLLEHQSIGPIF
DHIAALRGPISQFYQAILNGIGEAKELYEKINLNQPINNKVDLLLKQAEEVLQIMPSIYK
PRPQYTLYPAPKISSEQLEQRATAKRLRPFF
Download sequence
Identical sequences D3HKF5
gi|289165820|ref|YP_003455958.1| WP_003635766.1.28247 WP_003635766.1.35775 WP_003635766.1.41439 WP_003635766.1.55568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]