SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271963654|ref|YP_003337850.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271963654|ref|YP_003337850.1|
Domain Number 1 Region: 109-245
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.49e-26
Family GntR ligand-binding domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.16e-18
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|271963654|ref|YP_003337850.1|
Sequence length 255
Comment GntR family transcriptional regulator [Streptosporangium roseum DSM 43021]
Sequence
MLGQVLGDTAQSSVLSPVKVQSVATEVADRLMTAVAIGDYLPGERLPGERELATILDVSR
ATVREAIGRLQAVGIVEIKRGRTGGAYVRTSWTEATASAVRRTLLPRWPELEQLFDLRCL
VEGLVARTAALRRTDEDLAAMRVALDGYAQARTLGQEQAADAAFHGAVLAATGNPKISAL
SRDMLMRVSLGFPVEPYGEDDPEDYQRALIEHRKIYEAIAARDAEQAGSLAEEHFTLTSD
MMRAMLERAQERAAR
Download sequence
Identical sequences D2AXT6
WP_012888852.1.100029 gi|271963654|ref|YP_003337850.1| 479432.Sros_2122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]