SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271964652|ref|YP_003338848.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271964652|ref|YP_003338848.1|
Domain Number 1 Region: 2-185,332-420
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.01e-53
Family Bacterial dinuclear zinc exopeptidases 0.0041
Further Details:      
 
Domain Number 2 Region: 186-233,273-311
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000222
Family Bacterial exopeptidase dimerisation domain 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|271964652|ref|YP_003338848.1|
Domain Number - Region: 227-262
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0196
Family Cgl1923-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271964652|ref|YP_003338848.1|
Sequence length 421
Comment peptidase M20 [Streptosporangium roseum DSM 43021]
Sequence
MNEVAQICSDLIRFDTTNPGSGERPAAEHVAGLLSDAGIEPTVFESARNRTSVVARIPGD
SPEALLIHGHLDVVPAEPADWQVHPFSGEVADGCVWGRGAVDMKGTLSMTLALVRDWARR
GVRPKRDIVLAFLADEEATGEYGSRYAATRHRELFDGCTEAISESGGYSVQAPDARIYPV
AVGERGTAWMKLTAHGVAGHGSRPPKDNAVAELCHALSRIASYQWPVRLTPGVAALIAGL
ADILGEKIDYDRLEEEAERLGQAGALFKAQIRNSANPTMLEAGYKVNVVPGTATAHVDGR
FLPGYREEFLETIDRLLGPKVTREFVNIEDAPSAPLDAPFFGQLCDALVAEDPAARPVPY
VMSGGTDAKSFADIGIKGYGFAPLMLSPELDYYGMFHGVDERVPVEGLEFGMRVLDRLLA
S
Download sequence
Identical sequences D2BBN6
gi|271964652|ref|YP_003338848.1| 479432.Sros_3160 WP_012889850.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]