SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271964730|ref|YP_003338926.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271964730|ref|YP_003338926.1|
Domain Number 1 Region: 11-81
Classification Level Classification E-value
Superfamily Homeodomain-like 1.1e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0078
Further Details:      
 
Domain Number 2 Region: 87-198
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000381
Family Tetracyclin repressor-like, C-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|271964730|ref|YP_003338926.1|
Sequence length 201
Comment TetR family transcriptional regulator [Streptosporangium roseum DSM 43021]
Sequence
MPRISAPTIGEHRAQTQDRILQAVSRLSRDQGIDTISMTDVAGEAGITRTVLYNYFPDKA
ALLLAFTERVTHYFIESYERELPEQASPAERLRAFVRLQLAGLLAHPHPGPADLSAALGP
DAYQRLADHVAPMQDILTGIIDSGVTSGDFHAPDVAAAARIIFAVIGAERVPLLSGTVTP
HEAEETVCGFVLRGLGARTVS
Download sequence
Identical sequences D2BD94
479432.Sros_3240 WP_012889928.1.100029 gi|271964730|ref|YP_003338926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]