SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271967018|ref|YP_003341214.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|271967018|ref|YP_003341214.1|
Domain Number - Region: 311-436
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00549
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.017
Further Details:      
 
Domain Number - Region: 153-263
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0615
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271967018|ref|YP_003341214.1|
Sequence length 441
Comment 9-cis-epoxycarotenoid dioxygenase [Streptosporangium roseum DSM 43021]
Sequence
MTTPLYLRGFLAPVPDEIDAFDLPVSGALPPALTGRYFRNGPNPLPGRDPGHWFTGPGMV
HGVRLRDGRAEWYRNRWVRTREFTEDAPFVRDDLSVDLTAVPANTHVVPHGDKIFALVEN
GLPYELTAGLETVGPCDFGGLLTTAMTAHPKRDPLTGELLFFGYGFLPPYLTYHRLSADG
ELVESREVPVPGPTMMHDFAITAGHVVWMDLPVVFDLALAEGGGMPYRWDDRYGARLGVM
PRTGDAGVTWSDINPCYVFHTANAHEDGSGRVVLDTVRYTPAEFAAVWDDIGGSAHPAAR
AAVSGTAHLHRYVLTPGAASHEEQLDDLDVEFPTLHDGRTGDRNRYLYAVSSGAIVKYDV
RSGASILHKTGPDRMAGEAVFVPAEDARGEDEGWLISIVTGGPGVGSELLVLDAVDLSRV
ASVRLPRRVPAGFHGSWIQDG
Download sequence
Identical sequences D2ASE8
WP_012892208.1.100029 479432.Sros_5723 gi|271967018|ref|YP_003341214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]