SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|271968121|ref|YP_003342317.1| from Streptosporangium roseum DSM 43021

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|271968121|ref|YP_003342317.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 3.66e-85
Family Cgl1923-like 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|271968121|ref|YP_003342317.1|
Sequence length 302
Comment hypothetical protein [Streptosporangium roseum DSM 43021]
Sequence
MFDPTDLYRLSGDVPELTDPVLLYHFDGFVDAGGAGRLAIGHLLGELEHRVVATFDVDRL
LDYRSRRPIMTFDTDRWVSVESPEIALHLVQDSTGTPFLLLTGPEPDREWELFTAALGTL
ATRLKVSKLVTTHGIPMAVPHTRPLGVTGHATRPELVTGQTSAFGKVQVPGSVAALIEFR
LGAEGHDALGYAVHVPHYLAQAEYPAAAVTALEAVTRSTGLVFPLESLREAARSTDTEIA
EQIEASDELSTAITGLEQQYDAFAAGSKRENLMAEPSEMPTGDELAAQFEAFLAERDEQR
GD
Download sequence
Identical sequences D2B749
WP_012893305.1.100029 479432.Sros_6868 gi|271968121|ref|YP_003342317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]